Skip to main content

Recombinant Human TCF7L2 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00006934-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00006934-Q01-25ug
H00006934-Q01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 490-596 of Human TCF7L2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human TCF7L2 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00006934-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: TCF7L2

T cell transcription factor 4 (TCF 4) is a transcription factor of the high Mobility Group of DNA binding proteins and is a member of the TCF-LEF family of transcription factors. It interacts with b-Catenin in the Wnt signaling pathway to activate transcription of Wnt target genes. T cell transcription factor 4 plays important roles in embryogenesis and oncogenesis. High levels of expression are found in developing CNS and limb buds. The brain is the major site of expression, however, T cell transcription factor 4 mRNA is also found in high levels in liver, lower in heart, lungs, kidneys, and testis, and lowest in spleen and muscle. In human T cell transcription factor 4, four alternative splice sites are observed which correspond to the synthesis of many T cell transcription factor 4 isoforms with short, medium, or long-C-terminal ends (ADDINENRfu). BLAST searches showed these isoforms are very similar to each other, except those that are close to the C-terminus, however, the calculated molecular weights ranged from 52kD to 68kD.

Alternate Names

HMG box transcription factor 4, hTCF-4, T-cell factor 4, T-cell factor-4 variant A, T-cell factor-4 variant B, T-cell factor-4 variant C, T-cell factor-4 variant D, T-cell factor-4 variant E, T-cell factor-4 variant H, T-cell factor-4 variant I, T-cell factor-4 variant J, T-cell factor-4 variant K, T-cell factor-4 variant L, T-cell factor-4 variant M, T-cell factor-4 variant X2, T-cell-specific transcription factor 4, TCF-4T-cell factor-4 variant F, TCF4T-cell factor-4 variant G, transcription factor 7-like 2, transcription factor 7-like 2 (T-cell specific, HMG-box)

Gene Symbol

TCF7L2

Additional TCF7L2 Products

Product Documents for Recombinant Human TCF7L2 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human TCF7L2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...