Recombinant Human TIMM8B GST (N-Term) Protein

Name: Recombinant Human TIMM8B GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00026521-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00026521-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all TIMM8B Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-83 of Human TIMM8B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human TIMM8B GST (N-Term) Protein

SDS-PAGE: Recombinant Human TIMM8B GST (N-Term) Protein [H00026521-P01]

SDS-Page: Recombinant Human TIMM8B Protein [H00026521-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00026521-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: TIMM8B

TIMM8B belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM]

Alternate Names

DDP2DDP-like protein, DDPL, Deafness dystonia protein 2, FLJ21744, MGC102866, MGC117373, mitochondrial import inner membrane translocase subunit Tim8 B, TIM8Btranslocase of inner mitochondrial membrane 8 (yeast) homolog B, translocase of inner mitochondrial membrane 8 homolog B (yeast)

Gene Symbol

TIMM8B

Additional TIMM8B Products

Product Documents for Recombinant Human TIMM8B GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human TIMM8B GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews