Recombinant Human TMPRSS2 GST (N-Term) Protein

Name: Recombinant Human TMPRSS2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00007113-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00007113-Q01

Submit a review

Citations (1)

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot

View all TMPRSS2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 383-492 of Human TMPRSS2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human TMPRSS2 GST (N-Term) Protein

SDS-PAGE: Recombinant Human TMPRSS2 GST (N-Term) Protein [H00007113-Q01]

SDS-Page: Recombinant Human TMPRSS2 Protein [H00007113-Q01] - 12.5% SDS-PAGE using partial Recombinant Human TMPRSS2 Protein stained with Coomassie Blue. Molecular weight of ~ 37.84 KDa.

Formulation, Preparation and Storage

H00007113-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: TMPRSS2

TMPRSS2, also called Epitheliasin in mice, is a 492 amino acid type II transmembrane serine protease located on human chromosome 21q22.3 that encodes at least 2 isoforms. This glycosylated serine protease (theoretical molecular weight 70kDa) is regulated by androgens and expressed on the plasma membrane of human bronchial epithelial cells, nasal goblet cells, small intestine epithelia, gastrointestinal tract, the stomach, kidneys and pancreas, with the greatest abundance found in the prostate gland. While the physiological function of TMPRSS2 remains unknown, the serine protease domain undergoes autocleavage and the 32 kDa domain is secreted enabling its interaction with the extracellular matrix. Fusions between TMPRSS2 and the ETS transcription factor genes ERG, ETV1, and ETV4 have been reported in prostate cancer with the TMPRSS2 ERG gene fusion resulting in ERG overexpression in 40-80% of these cases and often producing a more aggressive phenotype. Androgen signaling is disrupted in prostate cancers with the TMPRSS2 ERG fusion which contributes to the switch from androgen dependent to androgen independent prostate cancer (1,2).

TMPRSS2 has also been shown to play a critical role in the process of viral entry for coronaviruses and influenza viruses thru proteolytic activation of key viral glycoproteins. One pathway for SARS-CoV-2 infection, which causes the COVID-19 disease, involves binding of the SARS-CoV-2 Spike 'S' glycoprotein to the human ACE2 receptor and cleavage of S by TMPRSS2 at the cell surface to facilitate viral entry. TMPRSS2 mediates viral entry in a similar mechanism for other coronaviruses such as SARS-CoV and MERS. The broad-spectrum serine protease inhibitor, Camostat, is a TMPRSS2 inhibitor demonstrated to protect mice with lethal SARS-CoV infections (3).

References

1. Clark, J., Cooper, C. (2009) ETS gene fusions in prostate cancer. Nat Rev Urol 6, 429-439. PMID: 19657377

2. Duffy, MJ. (2014) Chapter One - PSA in Screening for Prostate Cancer: More Good than Harm or More Harm than Good? Adv Clin Chem. 66:1-23. PMID: 25344984

3. Shen LW, Mao HJ, Wu YL, Tanaka Y, Zhang W. (2017) TMPRSS2: A potential target for treatment of influenza virus and coronavirus infections. Biochimie. 142:1-10

Long Name

Transmembrane protease, serine 2

Alternate Names

Epitheliasin, PP9284, PRSS10

Gene Symbol

TMPRSS2

Additional TMPRSS2 Products

Product Documents for Recombinant Human TMPRSS2 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human TMPRSS2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews