TrkA Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38265PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38265PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all TrkA Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NTRK1.

Source: E. coli

Amino Acid Sequence: KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38265.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38265PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TrkA

The Trk proto-oncogene encodes a 140 kDa, membrane-spanning protein tyrosine kinase that is expressed only in neural tissues. Nerve growth factor (NGF) stimulates phosphorylation of Trk A in neural cell lines and in embryonic dorsal root ganglia. Affinity cross-linking and equilibrium binding experiments with 125I-labeled NGF indicate that Trk A binds NGF specifically in cultured cells with a dissociation constant of 10(-9) molar. The identification of Trk A as an NGF receptor indicates that this protein participates in the primary signal transduction mechanism of NGF (1). Trk A was found to be expressed in the nervous system and phosphorylated in response to NGF (Nerve Growth Factor). Somatic rearrangement(s) of the TRKA gene (also designated NTRK1) are responsible for formation of some oncogenes (2). Trk A is expressed in neural and nonneuronal tissues. Like RET, Trk A is often activated by rearrangements that involve one of at least five other genes in papillary thyroid carcinoma (PTC) (3).

Long Name

Neurotrophic Tyrosine Kinase Receptor A

Alternate Names

NTRK-1, NTRK1

Gene Symbol

NTRK1

Additional TrkA Products

Product Documents for TrkA Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TrkA Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.