VISTA/B7-H5/PD-1H Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-59030PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-59030PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all VISTA/B7-H5/PD-1H Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Vsir.

Source: E. coli

Amino Acid Sequence: LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-59030.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-59030PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: VISTA/B7-H5/PD-1H

VISTA, also known as B7-H5, PD-1H, platelet receptor Gi24, Dies1, and SISP1, is a transmembrane glycoprotein that promotes both MT1-MMP expression and the MT1-MMP mediated activation of MMP-2. VISTA supports the differentiation of embryonic stem cells (ESC) and enhances BMP-4 induced signaling in ESC but is also downregulated following BMP-4 exposure. It binds to BMP-4 directly and also associates with the type I BMP receptor Activin RIB/ALK-4. VISTA is expressed on the surface of naïve CD4+ T cells, regulatory T cells, and adipocytes. It is upregulated in vivo on activated monocytes and dendritic cells. VISTA inhibits CD4+ and CD8+ T cell proliferation and their production of IL-2 and IFN-gamma. Its expression on tumor cells attenuates the anti-tumor immune response and enables more rapid tumor progression. In contrast, VISTA limits disease progression in the autoimmune disease model EAE.

Alternate Names

4632428N05Rik, B7-H5, C10orf54, Dies1, Gi24, PD-1H, PD1H, SISP1, VSIR

Gene Symbol

VSIR

Additional VISTA/B7-H5/PD-1H Products

Product Documents for VISTA/B7-H5/PD-1H Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for VISTA/B7-H5/PD-1H Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.