Skip to main content

Recombinant Human YAP1 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00010413-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00010413-P01-10ug
Arrives in 6 - 8 Business Days
10 ug / $569.00
H00010413-P01-25ug
Arrives in 6 - 8 Business Days
25 ug / $739.00

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Immunocytochemistry/ Immunofluorescence, Functional Assay, Microarray, Western Blot

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-504 of Human YAP1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

80.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Application Notes

Use in In vitro reported in scientific literature (PMID:33297404).

Protein / Peptide Type

Recombinant Protein

Reviewed Applications

Read 1 review rated 4 using H00010413-P01 in the following applications:

Scientific Data Images for Recombinant Human YAP1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human YAP1 GST (N-Term) Protein [H00010413-P01]

SDS-PAGE: Recombinant Human YAP1 GST (N-Term) Protein [H00010413-P01]

SDS-Page: Recombinant Human YAP1 Protein [H00010413-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00010413-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: YAP1

The transcriptional coactivator Yes-associated protein (YAP), also known as Yes-associated protein 1 (YAP1), Yes-Associated Protein YAP65 Homolog, Protein Yorkie Homolog and YAP65 has a theoretical molecular weight of 65 kDa. The YAP1 gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. YAP1 shares homology with the WW domain of transcriptional co-activator with PDZ-binding motif (TAZ), which functions as a transcriptional co-activator by binding to the PPXY motif present in transcription factors and is likely involved in protein-protein interaction. YAP has been identified as a core regulatory mechanism that blocks mammalian glial cell proliferation and cellular reprogramming following damage (1).

YAP plays a role in the development and progression of multiple cancers as a transcriptional regulator of the Hippo signaling pathway. YAP1 encodes a nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis to play a pivotal role in controlling cell growth and organ size and has emerged as a key player in tumor suppression (2,3). Deregulation of the Hippo pathway causes tumor formation and malignancy, with YAP being a key oncogenic driver in liver carcinogenesis (2) and may function as a potential target for cancer treatment (3).

References

1. Rueda, E. M., Hall, B. M., Hill, M. C., Swinton, P. G., Tong, X., Martin, J. F., & Poche, R. A. (2019). The Hippo Pathway Blocks Mammalian Retinal Muller Glial Cell Reprogramming. Cell Rep, 27(6), 1637-1649.e1636. doi:10.1016/j.celrep.2019.04.047

2. Liu, A. M., Xu, M. Z., Chen, J., Poon, R. T., & Luk, J. M. (2010). Targeting YAP and Hippo signaling pathway in liver cancer. Expert Opin Ther Targets, 14(8), 855-868. doi:10.1517/14728222.2010.499361

3.Ye, S., & Eisinger-Mathason, T. S. (2016). Targeting the Hippo pathway: Clinical implications and therapeutics. Pharmacol Res, 103, 270-278. doi:10.1016/j.phrs.2015.11.025

Long Name

Yes-associated Protein 1

Alternate Names

YAP2, YAP65, YKI, Yorkie Homolog

Gene Symbol

YAP1

Additional YAP1 Products

Product Documents for Recombinant Human YAP1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human YAP1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...
×