Aldo-keto Reductase 1C1/AKR1C1 Synthetic Peptide

Name: Aldo-keto Reductase 1C1/AKR1C1 Synthetic Peptide
Brand: Novus Biologicals
SKU: NBP1-68878PEP

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-68878PEP

Submit a review

Product Datasheet / COA

100% Guarantee

Product Specifications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Synthetic

Conjugate

Unconjugated

Applications

Antibody Competition, Western Blot

View all Aldo-keto Reductase 1C1/AKR1C1 Small Molecules and Peptides »

Product Specifications

Description

A blocking peptide from human Aldo-keto Reductase 1C1/AKR1C1.

Source: Synthetic

Amino Acid Sequence: LERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATW

Purity

N/A

Predicted Molecular Mass

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Application Notes

This is a synthetic peptide designed for use in combination with Aldo-keto Reductase 1C1/AKR1C1 Antibody (Catalog #: NBP1-68878). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochemistry under proper experimental settings. There is no guarantee for its use in other applications.

Protein / Peptide Type

Synthetic Peptide

Formulation, Preparation and Storage

NBP1-68878PEP

Formulation	Lyophilized
Preservative	No Preservative
Concentration	Lyoph
Reconstitution	Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Shipping	The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -20 degrees C. Avoid freeze/thaw cycles.

Background: Aldo-keto Reductase 1C1/AKR1C1

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Long Name

Aldo-keto Reductase Family 1, Member C1

Alternate Names

2-ALPHA-HSD, 20-ALPHA-HSD, AKR1C1, AldoketoReductase 1C1, DDH1, HAKRC, HBAB

Gene Symbol

AKR1C1

Additional Aldo-keto Reductase 1C1/AKR1C1 Products

Product Documents for Aldo-keto Reductase 1C1/AKR1C1 Synthetic Peptide

Product Datasheets

Download Product Datasheets

COA

Product Specific Notices for Aldo-keto Reductase 1C1/AKR1C1 Synthetic Peptide

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews