Amyloid β-peptide (42-1) (human)

Name: Amyloid β-peptide (42-1) (human)
Brand: Tocris Bioscience
SKU: 3391

Tocris Bioscience, part of Bio-Techne | Catalog # 3391

COA / SDS

Inactive control peptide for amyloid β-peptide (1-42) (Cat. No. 1428)

Discontinued Product

3391 has been discontinued. View all Amyloid beta Peptides products.

Key Product Details

Description:	Inactive control peptide for amyloid β-peptide (1-42) (Cat. No. 1428)
Purity:	≥95% (HPLC)
Molecular Weight:	4514.08

View Full Technical Details for Amyloid β-peptide (42-1) (human)

Technical Data
Citations

Biological Activity for Amyloid β-peptide (42-1) (human)

Amyloid β-peptide (42-1) (human) is an inactive control peptide for amyloid β-peptide (1-42), the predominant form of amyloid β-peptide found in the brains of patients with Alzheimer's disease.

Active Analog also available.

Technical Data for Amyloid β-peptide (42-1) (human)

M. Wt	4514.08
Formula	C₂₀₃H₃₁₁N₅₅O₆₀S
Single Letter Sequence	AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	317366-82-8
PubChem ID	16132430
InChi Key	PLOPBXQQPZYQFA-AXPWDRQUSA-N
Smiles	[H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Amyloid β-peptide (42-1) (human)

References are publications that support the biological activity of the product.

Xiong Mitochondrial respiratory inhibition and oxidative stress elevate β-secretase (BACE1) proteins and activity in vivo in the rat retina. Exp.Brain Res. 2007 PMID: 17429617
Boyd-Kimball Proteomic identification of proteins oxidized by Aβ(1-42) in synaptosomes: Implications for Alzheimer's disease. Brain Res. 2005 PMID: 15885219
Walsh Amyloid-beta peotide is toxic to neurons in vivo via indirect mechanisms. Neurobiol.Dis. 2002 PMID: 12079400

Amyloid β-peptide (42-1) (human)

Tocris Bioscience, part of Bio-Techne | Catalog # 3391

Key Product Details

Biological Activity for Amyloid β-peptide (42-1) (human)

Technical Data for Amyloid β-peptide (42-1) (human)

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for Amyloid β-peptide (42-1) (human)

Product Documents for Amyloid β-peptide (42-1) (human)

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

Stay Connected