CART (55-102) (rat)

Name: CART (55-102) (rat)
Brand: Tocris Bioscience
SKU: 3337

Tocris Bioscience, part of Bio-Techne | Catalog # 3337

Citations (1)

COA / SDS

Neuromodulatory neuropeptide fragment; satiety factor

Key Product Details

Description:	Neuromodulatory neuropeptide fragment; satiety factor
Purity:	≥95% (HPLC)
Molecular Weight:	5259.21

View Full Technical Details for CART (55-102) (rat)

Technical Data
Citations

Biological Activity for CART (55-102) (rat)

CART (55-102) (rat) is a cocaine- and amphetamine-regulated transcript (CART) with potent appetite-suppressing activity. Satiety factor; inhibits normal and starvation-induced feeding. Closely related to the actions of leptin and neuropeptide Y; blocks the neuropeptide Y-induced feeding response. Induces anxiety and stress behavior in rodents.

Technical Data for CART (55-102) (rat)

M. Wt	5259.21
Formula	C₂₂₆H₃₆₇N₆₅O₆₅S₇
Single Letter Sequence	IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Modifications: Disulfide bridges: 14-32, 20-40, 34-47)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	209615-79-2
PubChem ID	90488834
InChi Key	XXBSYMBQWAWYIX-UHFFFAOYSA-N
Smiles	[H]N[C@@H]([C@@H](C)CC)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CSSC[C@@H]3NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC4=CC=CC=C4)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC3=O)C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)[C@H](CC(O)=O)NC2=O)[C@@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC1=O)C(C)C)[C@@H](C)CC

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for CART (55-102) (rat)

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for CART (55-102) (rat)

References are publications that support the biological activity of the product.

Ludvigsen Solution structure of the satiety factor, CART, reveals new functionality of a well-known fold. Biochemistry 2001 PMID: 11478874
Chaki Cocaine- and amphetamine-regulated transcript peptide produces anxiety-like behavior in rodents. Eur.J.Pharmacol. 2003 PMID: 12600694
Thim CART, a new anorectic peptide. Int.J.Biochem.Cell Biol. 1998 PMID: 9924797