[D-Ala²]-GIP (human)

Name: [D-Ala 2 ]-GIP (human)
Brand: Tocris Bioscience
SKU: 6699

Tocris Bioscience, part of Bio-Techne | Catalog # 6699

Citations (4)

COA / SDS

Highly potent GIP agonist

Key Product Details

Description:	Highly potent GIP agonist
Purity:	≥95% (HPLC)
Molecular Weight:	4983.58

View Full Technical Details for [D-Ala²]-GIP (human)

Technical Data
Citations

Biological Activity for [D-Ala²]-GIP (human)

[D-Ala²]-GIP (human) is a highly potent GIP receptor agonist (EC₅₀ = 630 ± 119 pM). Displays equivalent cAMP stimulating properties and improved resistance to enzymatic degradation compared to native GIP (Cat. No. 2084) in cells expressing wild type GIP receptor. Improves glucose tolerance, insulin release and cognitive function in various animal models of obesity and diabetes. Displays neuroprotective effects in an MPTP model of PD.

Technical Data for [D-Ala²]-GIP (human)

M. Wt	4983.58
Formula	C₂₂₆H₃₃₈N₆₀O₆₆S
Single Letter Sequence	YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ (Modifications: Ala-2 = D-Ala)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	444073-04-5
Smiles	[H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for [D-Ala²]-GIP (human)

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for [D-Ala²]-GIP (human)

References are publications that support the biological activity of the product.

Porter Prolonged GIP receptor activation improves cognitive function, hippocampal synaptic plasticity and glucose homeostasis in high-fat fed mice. Eur.J.Pharmacol. 2011 PMID: 21050845
Verma Effect of D-Ala²GIP, a stable GIP receptor agonist on MPTP-induced neuronal impairments in mice. Eur.J.Pharmacol. 2017 PMID: 28366809
Hinke Dipeptidyl peptidase IV-resistant [D-Ala²]glucose-dependent Insotropic polypeptide (GIP) improves glucose tolerance in normal and obese diabetic rats. Diabetes. 2002 PMID: 11872663

[D-Ala²]-GIP (human)

Tocris Bioscience, part of Bio-Techne | Catalog # 6699

Key Product Details

Biological Activity for [D-Ala²]-GIP (human)

Technical Data for [D-Ala²]-GIP (human)

Solubility for [D-Ala²]-GIP (human)

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for [D-Ala²]-GIP (human)

Product Documents for [D-Ala²]-GIP (human)

COA

Certificate of Analysis

SDS

CONTACT INFORMATION

Stay Connected

[D-Ala2]-GIP (human)

Tocris Bioscience, part of Bio-Techne | Catalog # 6699

Key Product Details

Biological Activity for [D-Ala2]-GIP (human)

Technical Data for [D-Ala2]-GIP (human)

Solubility for [D-Ala2]-GIP (human)

Molarity Calculator

Dilution Calculator

Reconstitution Calculator

References for [D-Ala2]-GIP (human)

Product Documents for [D-Ala2]-GIP (human)

COA

Certificate of Analysis

SDS

[D-Ala²]-GIP (human)

Biological Activity for [D-Ala²]-GIP (human)

Technical Data for [D-Ala²]-GIP (human)

Solubility for [D-Ala²]-GIP (human)

References for [D-Ala²]-GIP (human)

Product Documents for [D-Ala²]-GIP (human)