Glucagon-like peptide 1 (7-36) amide (human, rat)

Name: Glucagon-like peptide 1 (7-36) amide (human, rat)
Brand: Tocris Bioscience
SKU: 2082

Tocris Bioscience, part of Bio-Techne | Catalog # 2082

Citations (3)

COA / SDS

Potent insulinotropic peptide

Key Product Details

Description:	Potent insulinotropic peptide
Alternative Names:	GLP-1 (7-36) amide
Purity:	≥95% (HPLC)
Molecular Weight:	3297.67

View Full Technical Details for Glucagon-like peptide 1 (7-36) amide (human, rat)

Technical Data
Citations

Biological Activity for Glucagon-like peptide 1 (7-36) amide (human, rat)

Glucagon-like peptide 1 (7-36) amide (human, rat) is a potent glucose-dependent insulinotropic peptide produced by post-translational processing of proglucagon in intestinal L-cells. Displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (K_d = 204 pM). Stimulates insulin gene transcription and secretion in pancreatic β-cells. Displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.

Technical Data for Glucagon-like peptide 1 (7-36) amide (human, rat)

M. Wt	3297.67
Formula	C₁₄₉H₂₂₆N₄₀O₄₅
Single Letter Sequence	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (Modifications: Arg-30 = C-terminal amide)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	107444-51-9
PubChem ID	16133831
InChi Key	DTHNMHAUYICORS-KTKZVXAJSA-N
Smiles	[H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Glucagon-like peptide 1 (7-36) amide (human, rat)

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Glucagon-like peptide 1 (7-36) amide (human, rat)

References are publications that support the biological activity of the product.

Perry Protection and reversal of excitotoxic neuronal damage by glucagon-like peptide-1 and exendin-4. J.Pharmacol.Exp.Ther. 2002 PMID: 12183643
Turton A role for glucagon-like peptide-1 in the central regulation of feeding. Nature 1996 PMID: 8538742
Perfetti and Merkel Glucagon-like peptide-1: a major regulator of pancreatic β-cell function. Eur.J.Endocrinol. 2000 PMID: 11124853
Goke and Conlon Receptors for glucagon-like peptide-1(7-37) amide on rat Insoma-derived cells. J.Endocrinol. 1988 PMID: 2832504