Liraglutide

Name: Liraglutide
Brand: Tocris Bioscience
SKU: 6517

Tocris Bioscience, part of Bio-Techne | Catalog # 6517

Citations (12)

COA / SDS

Highly potent, long-acting GLP-1 receptor agonist

Key Product Details

Description:	Highly potent, long-acting GLP-1 receptor agonist
Alternative Names:	NN2211
Purity:	≥95% (HPLC)
Molecular Weight:	3751.24

View Full Technical Details for Liraglutide

Technical Data
Citations

Biological Activity for Liraglutide

Liraglutide is a highly potent, long-acting GLP-1 receptor agonist (EC₅₀ = 61 pM). Acylated derivative of GLP-1 (7-37) (Cat. No. 5374). Inhibits food and water intake, causing lasting and reversible weight loss in normal and obese rats. In an animal model of Alzheimer's disease, Liraglutide decreases levels of Aβ and soluble amyloid, and reduces neuroinflammation.

Technical Data for Liraglutide

M. Wt	3751.24
Formula	C₁₇₂H₂₆₅N₄₃O₅₁
Single Letter Sequence	HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (Modifications: Lys-20 = Lys-(γ-Glu-palmitoyl))
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	204656-20-2
PubChem ID	16134956
InChi Key	YSDQQAXHVYUZIW-QCIJIYAXSA-N
Smiles	CCCCCCCCCCCCCCCC(=O)N[C@@H](CCC(=O)NCCCC[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)N)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC4=CC=C(C=C4)O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC5=CC=CC=C5)NC(=O)[C@H]([C@@H](C)O)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CC6=CN=CN6)N)C(=O)O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Liraglutide

Solubility

Soluble to 1mg/ml in 0.01M PBS (pH 7.4)

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Liraglutide

References are publications that support the biological activity of the product.

McClean The diabetes drug liraglutide prevents degenerative processes in a mouse model of Alzheimer's disease. J.Neurosci. 2011 PMID: 21525299
Larsen Systemic administration of the long-acting GLP-1 derivative NN2211 induces lasting and reversible weight loss in both normal and obese rats. Diabetes 2001 PMID: 11679431
Paladugu Liraglutide has anti-inflammatory and anti-amyloid properties in streptozotocin-induced and 5xFAD mouse models of Alzheimer's disease. Int.J.Mol.Sci. 2021 PMID: 33467075
Knudsen Potent derivatives of glucagon-like peptide-1 with pharmacokinetic properties suitable for once daily administration. J.Med.Chem. 2000 PMID: 10794683