Skip to main content

TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-26245

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-26245
NBP2-26245-5mg

Key Product Details

Species

Human, Mouse

Applications

Flow Cytometry, Functional Assay

Product Summary for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

TLR2 / TLR4 Inhibitor Peptide: 1 mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da

Antennapedia Control Peptide: 1 mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da

Product Specifications

Specificity

TLR2 and TLR4 Inhibitor Peptide: COBRA
TLR2 and TLR4 Inhibitor interferes with interaction between TIRAP/Mal and TIR domain of TLR2 or TLR4.

Applications

Flow Cytometry (reported in scientific literature (PMID 27838489))
In vitro assay (reported in scientific literature (PMID 26908090))

Application Notes

The inhibitor is used in assays to inhibit TLR2 and TLR4 signaling. We recommend an initial titration of the inhibitor from 0-50 uM for in vitro assays along with control of which concentrations should be mirror inhibitor concentrations. Inhibitor and control should be preincubated with cells prior to ligand activation to allow sufficient time for the peptides to enter from the media into the cell. We typically preincubate with inhibitor and control for 1 h prior to TLR2 or TLR4 activation (Figures 1 and 2); however, optimal preincubation times may vary between model systems. The TLR2/NF-kB/SEAPorter™ cell line and TLR4/MD2/CD14/NF-kB/SEAPorter™ cell line are a useful positive control model system for studying inhibition of TLR2 and TLR4 activation, respectively (Figures 1 through 3).

Scientific Data Images for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Other: TIRAP (TLR2 and TLR4) Inhibitor Peptide Set [NBP2-26245]

Other: TIRAP (TLR2 and TLR4) Inhibitor Peptide Set [NBP2-26245]

TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - TLR2 acts through formation of heterodimer complexes with TLR1 or TLR6. HEK 293 endogenously expresses TLR1 and TLR6, so that the TLR2 reporter cell line can response to both Pam3CSK4 (TLR2/TLR1 specific ligand) and MALP-2 (TLR2/TLR6 specific ligand). The TLR2 / TLR4 inhibitor specifically inhibits TLR2/TLR1 receptor complex activity in a dose-response manner but exhibited no or little effect on TLR2/TLR6 receptor complex activity.
Other: TIRAP (TLR2 and TLR4) Inhibitor Peptide Set [NBP2-26245]

Other: TIRAP (TLR2 and TLR4) Inhibitor Peptide Set [NBP2-26245]

TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - The TLR4 reporter cell line responds to LPS. The TLR2 / TLR4 inhibitor specifically inhibits TLR4 activation upon LPS stimulation in a dose-response manner.
Other: TIRAP (TLR2 and TLR4) Inhibitor Peptide Set [NBP2-26245]

Other: TIRAP (TLR2 and TLR4) Inhibitor Peptide Set [NBP2-26245]

TIRAP (TLR2 and TLR4) Inhibitor Peptide [NBP2-26245] - TLR2 /4 Inhibitor suppressed the Pam3CSK4-induced TLR2/TLR1 activity [A] and the LPS-induced TLR4 activity [B] in a dose-response manner, of which IC50 values were measured as 17.2 uM and 10.47 uM, respectively.

Formulation, Preparation, and Storage

Preparation Method

Preparation of 2.5 mM peptide stock solutions
TLR2 / TLR4 Inhibitor Peptide: A final volume of 100 ul will make a 2.5 mM stock solution. Add 100 ul sterile water to the tube of peptide. Carefully pipet to ensure all of the peptide is dissolved and briefly spin the tube before opening.

Antennapedia Control Peptide: A final volume of 170 ul will make a 2.5 mM stock solution. Add 170 ul sterile water to the tube of peptide. Carefully pipet to ensure all of the peptide is dissolved and briefly spin the tube before opening.

The stock solutions may be diluted further to make working solutions. Dilute according to the needs for your assay. For example, dilute 2.5 mM stock solutions 1:10 in sterile 1X PBS or cell culture media to make 250 uM working solutions. Working solution should be made fresh daily and not be stored.

Formulation

Form: White solid
Solubilize the peptides prior to use by preparing 2.5 mM stock solution in sterile water.

Concentration

Concentration is not relevant for this product. Please see the protocols for proper use of this product.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: TIRAP (TLR2 and TLR4)

TIRAP/Mal is an adapter protein in the signaling pathways activated by TLR2 and TLR4, and appears to be essential for MyD88-dependent TLR2 and TLR4 signaling pathways. TIRAP is recruited to activated TL2 and TLR4 through interaction with TIR domain of the receptor. This peptide contains a sequence from mouse TIRAP that blocks the function of TIRAP, likely through binding to the receptor and blocking TIR-TIR domain interaction between TIRAP and the receptor.

Alternate Names

adapter protein wyatt, Adaptor protein Wyatt, FLJ42305, MAL, MyD88 adapter-like protein, TIR domain-containing adapter protein, toll/interleukin-1 receptor domain-containing adapter protein, toll-interleukin 1 receptor (TIR) domain containing adaptor protein, Toll-interleukin 1 receptor (TIR) domain-containing adaptor protein, Toll-like receptor adaptor protein, wyatt

Gene Symbol

TIRAP

Additional TIRAP (TLR2 and TLR4) Products

Product Documents for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Inhibitors are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...
Loading...
×