Actin Antibody (3U6B8)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16100

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16100-100ul
NBP3-16100-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3U6B8

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Actin Antibodies »

Product Summary for Actin Antibody (3U6B8)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 278-377 of human alpha-Actin-1 (ACTA1) (P68133). ETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Actin Antibody (3U6B8)

Western Blot: Actin Antibody (3U6B8) [NBP3-16100]

Western Blot: Actin Antibody (3U6B8) [NBP3-16100]

Western Blot: Actin Antibody (3U6B8) [NBP3-16100] - Western blot analysis of extracts of various cell lines, using Actin Rabbit mAb (NBP3-16100) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry: Actin Antibody (3U6B8) [NBP3-16100]

Immunohistochemistry: Actin Antibody (3U6B8) [NBP3-16100]

Immunohistochemistry: Actin Antibody (3U6B8) [NBP3-16100] - Immunofluorescence analysis of mouse skeletal muscle using Actin Rabbit mAb (NBP3-16100) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Actin Antibody (3U6B8) [NBP3-16100]

Immunohistochemistry-Paraffin: Actin Antibody (3U6B8) [NBP3-16100]

Immunohistochemistry-Paraffin: Actin Antibody (3U6B8) [NBP3-16100] - Immunohistochemistry of paraffin-embedded rat lung using Actin Rabbit mAb (NBP3-16100) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 3 more images

Applications for Actin Antibody (3U6B8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Actin

Actin is a 43kDa filament protien that is ubiquitously expressed by all eukaryotic cells. This wide expression makes Actin an ideal "housekeeping gene", which may even account for up to 50% of total cellular protein. Actin microfilaments can form both stable and labile structures and are crucial components of microvilli and the contractile apparatus of muscle cells. While lower eukaryotes, such as yeast, have only one Actin gene, higher eukaryotes have several isoforms encoded by a family of genes. At least six types of Actin are present in mammalian tissues and fall into three classes. alpha Actin expression is limited to various types of muscle, whereas beta and gamma are the principle constituents of filaments in other tissues. Members of the small GTPase family regulate the organization of the Actin cytoskeleton. Rho controls the assembly of Actin stress fibers and focal adhesion, Rac regulates Actin filament accumulation at the plasma membrane and Cdc42 stimulates formation of filopodia. Actin antibodies are most commonly used as controls for protein standardization or in cytoskeletan or cell cycle research.

Alternate Names

ACTA, actin, alpha 1, skeletal muscle, alpha skeletal muscle, alpha skeletal muscle actin, Alpha-actin-1, ASMA, CFTD, CFTDM, MPFD, NEM1, NEM2, NEM3

Gene Symbol

ACTA1

Additional Actin Products

Product Documents for Actin Antibody (3U6B8)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Actin Antibody (3U6B8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.