Activin RIB/ALK-4 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-39003

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-39003
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Activin RIB/ALK-4 Antibodies »

Product Summary for Activin RIB/ALK-4 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Activin RIB/ALK-4 Antibody

Western Blot: Activin RIB/ALK-4 Antibody [NBP2-39003]

Western Blot: Activin RIB/ALK-4 Antibody [NBP2-39003]

Western Blot: Activin RIB/ALK-4 Antibody [NBP2-39003] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunocytochemistry/ Immunofluorescence: Activin RIB/ALK-4 Antibody [NBP2-39003]

Immunocytochemistry/ Immunofluorescence: Activin RIB/ALK-4 Antibody [NBP2-39003]

Immunocytochemistry/Immunofluorescence: Activin RIB/ALK-4 Antibody [NBP2-39003] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody [NBP2-39003]

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody [NBP2-39003]

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody [NBP2-39003] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Applications for Activin RIB/ALK-4 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Activin RIB/ALK-4

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type IB receptor, composed of 11 exons. Alternative splicing and alternative polyadenylation result in 3 fully described transcript variants. The mRNA expression of variants 1, 2, and 3 is confirmed, and a potential fourth variant contains an alternative exon 8 and lacks exons 9 through 11, but its mRNA expression has not been confirmed.

Long Name

Activin Receptor IB

Alternate Names

ActivinRIB, ACVR1B, ALK-4, ALK4

Gene Symbol

ACVR1B

UniProt

P36896

Additional Activin RIB/ALK-4 Products

Product Documents for Activin RIB/ALK-4 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Activin RIB/ALK-4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.