beta-1 Adrenergic R/ADRB1 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16089

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16089
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all beta-1 Adrenergic R/ADRB1 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 350-450 of human beta-1 Adrenergic R/ADRB1 (NP_000675.1). HRELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQGLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for beta-1 Adrenergic R/ADRB1 Antibody - Azide and BSA Free

Western Blot: beta-1 Adrenergic R/ADRB1 AntibodyAzide and BSA Free [NBP3-16089]

Western Blot: beta-1 Adrenergic R/ADRB1 AntibodyAzide and BSA Free [NBP3-16089]

Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP3-16089] - Western blot analysis of extracts of various cell lines, using beta-1 Adrenergic R/ADRB1 antibody (NBP3-16089) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Applications for beta-1 Adrenergic R/ADRB1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 50% glycerol, pH7.3

Format

Azide and BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: beta-1 Adrenergic R/ADRB1

Alpha-2-adrenergic receptors are members of the G protein-coupled receptor superfamily. They include 3 highly homologous subtypes: alpha2A, alpha2B, and alpha2C. These receptors have a critical role in regulating neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system. Studies in mouse revealed that both the alpha2A and alpha2C subtypes were required for normal presynaptic control of transmitter release from sympathetic nerves in the heart and from central noradrenergic neurons; the alpha2A subtype inhibited transmitter release at high stimulation frequencies, whereas the alpha2C subtype modulated neurotransmission at lower levels of nerve activity. This gene encodes alpha2A subtype and it contains no introns in either its coding or untranslated sequences.

Long Name

Beta-1 Adrenergic Receptor

Alternate Names

ADRB1, ADRB1R, beta-1 AdrenergicR, beta1 AdrenergicR

Gene Symbol

ADRB1

Additional beta-1 Adrenergic R/ADRB1 Products

Product Documents for beta-1 Adrenergic R/ADRB1 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for beta-1 Adrenergic R/ADRB1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.