FKBP12 Antibody (9A2J5)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15418

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15418-100ul
NBP3-15418-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9A2J5

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all FKBP12 Antibodies »

Product Summary for FKBP12 Antibody (9A2J5)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 29-108 of human FKBP12 (P62942). GMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FKBP12 Antibody (9A2J5)

Western Blot: FKBP12 Antibody (9A2J5) [NBP3-15418]

Western Blot: FKBP12 Antibody (9A2J5) [NBP3-15418]

Western Blot: FKBP12 Antibody (9A2J5) [NBP3-15418] - Western blot analysis of extracts of various cell lines, using FKBP12 Rabbit mAb (NBP3-15418) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Western Blot: FKBP12 Antibody (9A2J5) [NBP3-15418]

Western Blot: FKBP12 Antibody (9A2J5) [NBP3-15418]

Western Blot: FKBP12 Antibody (9A2J5) [NBP3-15418] - Western blot analysis of extracts of U-251MG cells, using FKBP12 Rabbit mAb (NBP3-15418) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Applications for FKBP12 Antibody (9A2J5)

Application
Recommended Usage

Western Blot

1:500 - 1:1000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: FKBP12

Immunophilins are a family of soluble receptors capable of binding to one of two major immunosuppressant agents; cyclosporin A (CsA) or FK506. Proteins that bind FK506 are termed FK506 Binding Proteins (FKBPs) and those that bind cyclosporin A are called cyclophilins (CyP). Immunophilins function as cis-trans peptidyl-prolyl isomerases (PPIase) whose activity is inhibited by their respective immunosuppressant compounds. Thus, immunophilins accelerate folding of some proteins both in vivo and in vitro by catalyzing slow steps in the initial folding and rearrangement of proline-containing proteins.FKBP12:FK506 complexes inhibit calcineurin, a calcium/calmodulin-dependent serine/threonine phosphatase which blocks T-cell activation by preventing lymphokine gene transcription. FKBP12 also plays a role in intracellular calcium regulation by associating with three types of calcium release channel complexes, cardiac and skeletal ryanodine receptors and the inositol 1,4,5-trisphosphate receptor. In interactions with members of the TGF beta family type I receptors, FKBP12 has been shown to exert an inhibitory effect on the signaling pathway.

Long Name

12 kDa FK506 Binding Protein

Alternate Names

FKBP1a, PKC12, PPIASE

Gene Symbol

FKBP1A

Additional FKBP12 Products

Product Documents for FKBP12 Antibody (9A2J5)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for FKBP12 Antibody (9A2J5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.