Skip to main content

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Intracellular Staining by Flow Cytometry

Cited:

Flow Cytometry

Label

Alexa Fluor 488 (Excitation = 488 nm, Emission = 515-545 nm)

Antibody Source

Monoclonal Mouse IgG1 Clone # 190125

Product Specifications

Immunogen

Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818

Specificity

Detects human Osteocalcin in direct ELISAs.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Scientific Data Images for Human Osteocalcin Alexa Fluor® 488-conjugated Antibody

Detection of Osteocalcin antibody in Saos-2 Human Cell Line antibody by Flow Cytometry.

Detection of Osteocalcin in Saos-2 Human Cell Line by Flow Cytometry.

Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human Osteocalcin Alexa Fluor® 488-conjugated Monoclonal Antibody (Catalog # IC1419G, filled histogram) or isotype control antibody (Catalog # IC002G, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
Detection of Osteocalcin antibody in Human Osteoblasts antibody by Flow Cytometry.

Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry.

Human osteoblasts were stained with Mouse Anti-Human Osteocalcin Alexa Fluor® 488-conjugated Monoclonal Antibody (Catalog # IC1419G, filled histogram) or isotype control antibody (Catalog # IC002G, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.

Applications for Human Osteocalcin Alexa Fluor® 488-conjugated Antibody

Application
Recommended Usage

Intracellular Staining by Flow Cytometry

5 µL/106 cells
Sample: Saos‑2 human osteosarcoma cell line and human osteoblasts were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005)

Reviewed Applications

Read 1 review rated 4 using IC1419G in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A or G purified from hybridoma culture supernatant

Formulation

Supplied in a saline solution containing BSA and Sodium Azide.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Protect from light. Do not freeze.
  • 12 months from date of receipt, 2 to 8 °C as supplied.

Background: Osteocalcin

Osteocalcin, also known as Bone gamma-Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

References

  1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Long Name

Bone gamma-Carboxyglutamate [gla] Protein

Alternate Names

BGLAP, BGP, OCN

Entrez Gene IDs

632 (Human); 12096 (Mouse); 25295 (Rat)

Gene Symbol

BGLAP

UniProt

Additional Osteocalcin Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Note: Certificate of Analysis not available for kit components.

Product Specific Notices for Human Osteocalcin Alexa Fluor® 488-conjugated Antibody


This product is provided under an agreement between Life Technologies Corporation and R&D Systems, Inc, and the manufacture, use, sale or import of this product is subject to one or more US patents and corresponding non-US equivalents, owned by Life Technologies Corporation and its affiliates. The purchase of this product conveys to the buyer the non-transferable right to use the purchased amount of the product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components (1) in manufacturing; (2) to provide a service, information, or data to an unaffiliated third party for payment; (3) for therapeutic, diagnostic or prophylactic purposes; (4) to resell, sell, or otherwise transfer this product or its components to any third party, or for any other commercial purpose. Life Technologies Corporation will not assert a claim against the buyer of the infringement of the above patents based on the manufacture, use or sale of a commercial product developed in research by the buyer in which this product or its components was employed, provided that neither this product nor any of its components was used in the manufacture of such product. For information on purchasing a license to this product for purposes other than research, contact Life Technologies Corporation, Cell Analysis Business Unit, Business Development, 29851 Willow Creek Road, Eugene, OR 97402, Tel: (541) 465-8300. Fax: (541) 335-0354.

For research use only

Loading...
Loading...
Loading...
Loading...
Loading...