Inhibin alpha Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87563

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-87563
NBP1-87563-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Inhibin A Antibodies »

Product Summary for Inhibin alpha Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLAT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Inhibin alpha Antibody

Immunocytochemistry/ Immunofluorescence: Inhibin alpha Antibody [NBP1-87563]

Immunocytochemistry/ Immunofluorescence: Inhibin alpha Antibody [NBP1-87563]

Immunocytochemistry/Immunofluorescence: Inhibin alpha Antibody [NBP1-87563] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563]

Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563]

Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563] - Staining in human testis and endometrium tissues using anti-INHA antibody. Corresponding INHA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563]

Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563]

Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563] - Staining of human endometrium shows low expression as expected.
View 1 more images

Applications for Inhibin alpha Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Inhibin A

INHA(A-inhibin subunit precursor, inhibin alpha subunit ),also called inhibin(alpha) ,which is located on chromosome 2q33-q36. Inhibin is a gonadal protein that preferentially suppresses the secretion of pituitary follicle-stimulating hormone (FSH). Inhibin comprises of two subunits,Inhibin A and B. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumor suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa cell tumors and can therefore be used as a marker for primary as well as recurrent disease. In addition to their role in endocrine feedback in the reproductive sytem, inhibins subserve local regulatory roles in numerous extragonadal tissues, including brain, adrenal,bone marrow, placenta, and most notably anterior pituitary. Inhibin alpha subunit gene expression is down regulated in human prostate cancer, suggesting a tumor suppressive role.

Alternate Names

INHA, Inhibin A

Gene Symbol

INHA

Additional Inhibin A Products

Product Documents for Inhibin alpha Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Inhibin alpha Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.