SerpinB9 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33924

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-33924
NBP2-33924-25ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all SerpinB9 Antibodies »

Product Summary for SerpinB9 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: YFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SerpinB9 Antibody

Immunocytochemistry/ Immunofluorescence: SerpinB9 Antibody [NBP2-33924]

Immunocytochemistry/ Immunofluorescence: SerpinB9 Antibody [NBP2-33924]

Immunocytochemistry/Immunofluorescence: SerpinB9 Antibody [NBP2-33924] - Staining of human cell line A549 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SerpinB9 Antibody [NBP2-33924]

Immunohistochemistry-Paraffin: SerpinB9 Antibody [NBP2-33924]

Immunohistochemistry-Paraffin: SerpinB9 Antibody [NBP2-33924] - Staining of human spleen shows moderate cytoplasmic positivity in the cells of the white pulp of spleen.

Applications for SerpinB9 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SerpinB9

SerpinB9 is a serine proteinase inhibitor of the ovalbumin like B clade of serpins. The mouse orthologue to PI9 is SPI-6. SerpinB9 was first discovered in human bone marrow in a search for serpins similar to SerpinB6. SerpinB9 was identified in lymphocytes, especially natural killer cells and cytotoxic T lymphocytes, cells which also produce and store the apoptosis-inducing enzyme Granzyme B. PI9 was shown to be a potent inhibitor of Granzyme B, working at picamolar efficiencies. PI9 was also shown to inhibit caspase 1, the interleukin 1 converting enzyme, thus blocking IL1 223; production, and decreasing inflammatory processes. Most leukemia cells and many tumor cells produce PI9, leading to speculation that PI9 may help protect tumor cells from destruction by NK and CTL cells. PI9 is also found in placenta, lung, kidney, mast cells, and many tissues and cell lines. In kidney transplant, PI9 is sharply elevated, and in the liver PI9 has been shown to be upregulated by a downstream estrogen promoter. SerpinB9 inhibits Granzyme B, and is cleaved by Granzyme M, as a down regulatory step. SerpinB9 also inhibits the bacterial proteinase subtilisin A, and this may be a protective agent against infections. Neutrophil elastase is also a target of SerpinB9. Like SerpinB6 and SerpinB8, SerpinB9 lacks a signal sequence, and is found mainly in the cytoplasm and nucleus, although it can be detected outside of cells and in serum. The original SerpinB9 sequence described was 379 amino acids in length, with predicted mass of 42.4 kDa and pI of 5.51.

Alternate Names

CAP-3, CAP3PI-9, Cytoplasmic antiproteinase 3, Peptidase inhibitor 9, PI9protease inhibitor 9 (ovalbumin type), serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9, serpin B9, serpin peptidase inhibitor, clade B (ovalbumin), member 9, serpin peptidase inhibitor, clade B, member 9

Gene Symbol

SERPINB9

UniProt

P50453 (Human)

Additional SerpinB9 Products

Product Documents for SerpinB9 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for SerpinB9 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.