TREM2 Antibody [Alexa Fluor® 488]
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35146AF488

Key Product Details
Species Reactivity
Applications
Label
Antibody Source
Concentration
Product Specifications
Immunogen
Sequence:
HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISR
Clonality
Host
Isotype
Applications for TREM2 Antibody [Alexa Fluor® 488]
ELISA
Immunocytochemistry/ Immunofluorescence
Western Blot
Formulation, Preparation, and Storage
Purification
Formulation
Preservative
Concentration
Shipping
Stability & Storage
Background: TREM2
TREM2 is upregulated under many pathological conditions and has been of particular interest in neurodegenerative disorders like Alzheimer's disease (AD) where it helps activate microglial responses (1-3,5). Studies have found that sTREM2 is typically elevated in the cerebral spinal fluid (CSF) of AD patients compared to healthy counterparts and may serve as a biomarker of AD (2). While TREM2-mediated microglial activation is considered beneficial in some disease contexts (e.g. demyelinating diseases, ischemia), it is detrimental in others (e.g. peripheral nerve injury) and may be dependent on disease stage, as observed in AD (2,5). Microglia promote amyloid-beta (Abeta) clearance, phagocytosis and reduce tau proliferation in the early stages of AD but can increase Abeta accumulation and tau propagation in late stages of AD (2). Recent studies have also suggested a role for TREM2 in cancer, where it supports an immune-suppressive tumor microenvironment such as reduced of T cell proliferation (1,6). Therapeutic targeting of the TREM2 pathway can be directed towards ligand binding to downstream signaling (1). Potential therapeutic strategies include using monoclonal antibodies or small molecules to either enhance or block signaling (1,6). While more work needs to be done, initial studies targeting TREM2 for cancer immunotherapy is promising (6).
References
1. Deczkowska A, Weiner A, Amit I. The Physiology, Pathology, and Potential Therapeutic Applications of the TREM2 Signaling Pathway. Cell. 2020; 181(6):1207-1217. https://doi.org/10.1016/j.cell.2020.05.003
2. Qin Q, Teng Z, Liu C, Li Q, Yin Y, Tang Y. TREM2, microglia, and Alzheimer's disease. Mech Ageing Dev. 2021; 195:111438. https://doi.org/10.1016/j.mad.2021.111438
3. Kober DL, Brett TJ. TREM2-Ligand Interactions in Health and Disease. J Mol Biol. 2017; 429(11):1607-1629. https://doi.org/10.1016/j.jmb.2017.04.004
4. Uniprot (Q9NZC2)
5. Konishi H, Kiyama H. Microglial TREM2/DAP12 Signaling: A Double-Edged Sword in Neural Diseases. Front Cell Neurosci. 2018; 12:206. https://doi.org/10.3389/fncel.2018.00206
Long Name
Alternate Names
Gene Symbol
Additional TREM2 Products
Product Documents for TREM2 Antibody [Alexa Fluor® 488]
Product Specific Notices for TREM2 Antibody [Alexa Fluor® 488]
Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.