Activin RIIA Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-91647PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-91647PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Activin RIIA Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACVR2A.

Source: E. coli

Amino Acid Sequence: CEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91647.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-91647PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Activin RIIA

Activin, a disulfide-linked homodimeric protein is secreted by Sertoli cells in the testis and granulosa cells in the ovary. In early studies, this peptide was thought to be an inhibin and not recognized as a unique compound. Activins and inhibins are members of the TGF-beta superfamily due to amino acid homology with respect to the conservation of 7 of the 9 cysteine residues common to all TGF-beta forms. Activins are homodimers or heterodimers of the various beta subunit isoforms, while inhibins are heterodimers of a unique alpha subunit and one of the various beta subunits. Five beta subunits have been cloned (mammalian betaA, betaB, betaC, betaE, and Xenopus betaD). The activin/inhibin nomenclature reflects the subunit composition of the proteins: activin A (betaA-betaA), activin B (betaB-betaB), activin AB (betaB-betaA), inhibin A (alpha-betaA), and inhibin B (alpha- betaB). Activins have a wide range of biological activities including mesoderm induction, neural cell differentiation, bone remodeling, hematopoiesis, and reproductive physiology. Activins are also involved in growth and differentiation of several tissues from different species. This protein also plays a key role in the production and regulation of hormones such as FSH, LH, GnRH, and ACTH. Activin influences erythropoiesis and the potentiation of erythroid colony formation, oxytocin secretion, paracrine, and autocrine regulation. Similar to other TGF-beta family members, activins exert their biological activities through the effects ot the heterodimeric complex composed of two membrane spanning serine-threonine kinases designated type I and type receptors. Activin type I and type II receptors are distinguished by the level of sequence homology of their kinase domains and other structural and functional features. To date, seven type I and five type II activin receptors have been cloned from mammals, including activin receptor IA, activin receptor IIA, activin receptor IB, and activin receptor IIB. In addition, two splicevariants of activin receptor IIA and five splice variants of activin receptor IIB have been reported. Type I activin receptors are highly conserved and do not bind directly to activin but will associate with the type II receptor-activin complex and initiate signal transduction. Type I activin receptors will also bind with the BMP-2/7-bound BMPR-II and form signaling complexes. Human, mouse, and bovine type IB activin receptors share greater than 98 % homology.

Long Name

Activin Receptor IIA

Alternate Names

ActivinRIIA, ACVR2A, AVR2A

Gene Symbol

ACVR2A

Additional Activin RIIA Products

Product Documents for Activin RIIA Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Activin RIIA Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.