Recombinant Human Adrenomedullin R/ADMR/GPR182 Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00011318-G01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00011318-G01
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

Wheat germ

Conjugate

Unconjugated

Applications

Affinity Purification

View all Adrenomedullin R/ADMR Proteins and Enzymes »

Product Specifications

Description

An untagged recombinant protein corresponding to the amino acid sequence of (NP_009195.1) for Human Adrenomedullin R/ADMR/GPR182

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

45.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Formulation, Preparation and Storage

H00011318-G01
Preparation Method in vitro wheat germ expression system with proprietary liposome technology
Formulation 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative Glycerol
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Adrenomedullin R/ADMR

G Protein-Coupled Receptor L1/G10D has been suggested to be an Adrenomedullin Receptor. Originally cloned from rats and later from humans, L1/G10D does not to bind adrenomedullin or display functional cAMP response to adrenomedullin (reviewed in Poyner et al. 2002). The initial experimental results, which demonstrated high-affinity binding and increased levels of cAMP in COS cells that were transfected with L1/G10D and treated with adrenomedullin, could not be reproduced by other laboratories (Kapas et al. 1995). It is now known that the functional adrenomedullin receptor is a heterodimeric complex composed of calcitonin receptor-like receptor (CRLR) and receptor activity modifying proteins (RAMPs) (McLatchie et al. 1998). L1/G10D therefore should be considered an Orphan A receptor. L1/G10D expression has been reported in adrenal gland, bone marrow, brain, heart, kidney, liver, lung, lymph node, pancreas, skeletal muscle, small intestine, spleen, stomach, testis, and thyroid. ESTs have been isolated from kidney, liver/spleen, fetal lung/testis/B-cell, and melanocyte/uterus/fetal heart libraries.

Long Name

Adrenomedullin Receptor

Alternate Names

7TMR, ADMR, AdrenomedullinR, AMR, G10D, GAMRH, Gpcr22, GPR182, MB10, NOW

Gene Symbol

GPR182

Additional Adrenomedullin R/ADMR Products

Product Documents for Recombinant Human Adrenomedullin R/ADMR/GPR182 Protein

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human Adrenomedullin R/ADMR/GPR182 Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.