Skip to main content

MORC4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33874PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33874PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MORC4.

Source: E. coli

Amino Acid Sequence: SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYPEASKNTGQNREVSILYPGAKDQRQGSLLPEELEDQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33874.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33874PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MORC4

The MORC4 gene encodes a MORC family CW-type zinc finger protein 4 that exists in three isoforms: isoform 1: 937 amino acids long, 106 kDA; isoform 2: 648 amino acids long, 74 kDA; and isoform 3: 900 amino acids long, 101 kDA. The MORC4 gene is frequently found in low concentrations in normal tissues and elevated levels in placenta and testis. The protein encoded by this gene functions in nuclear matrix binding domains and a two-stranded coiled-coil motif near the C-terminus. MORC4 interacts with genes SKIL, STAT3, UBC, PRKAA1, and GEMIN4. It has been linked to large b-cell lymphoma.

Alternate Names

CW type with coiled-coil domain 2, FLJ11565, MORC family CW-type zinc finger 4, ZCW4, ZCWCC2

Gene Symbol

MORC4

Additional MORC4 Products

Product Documents for MORC4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MORC4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...