Skip to main content

PEDFR/PNPLA2/ATGL Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57480PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57480PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEDF R/PNPLA2/ATGL.

Source: E. coli

Amino Acid Sequence: FSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57480.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57480PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PEDFR/PNPLA2

Patatin-like phospholipase domain-containing protein 2 (PNPLA2), also known as adipose triglyceride lipase (ATGL), is a lipolytic enzyme required for mobilization of fatty acids from triglyceride stores in adipose tissue. Until recently, hormone-sensitive lipase (HSL) was the only enzyme known to hydrolyze triglycerides in mammalian adipose tissue. However, ATGL has now been shown to catalyze the initial step of triglyceride hydrolysis in adipocyte and non-adipocyte lipid droplets. Thus, ATGL and HSL coordinate to catabolize stored triglycerides in adipose tissue of mammals.

Defects in PNPLA2 can lead to neutral lipid storage disease with myopathy (NLSDM), a neutral lipid storage disorder with myopathy but without ichthyosis.

ATGL antibodies can serve as useful tools for adipocyte studies and research on triglyceride processing and fat storage.

Long Name

Pigment Epithelium-derived Factor Receptor/Patatin-like Phospholipase Domain-containing Protein 2

Alternate Names

ATGL, Desnutrin, IPLA2-zeta, PEDF R, PNPLA2, TTS2

Gene Symbol

PNPLA2

Additional PEDFR/PNPLA2 Products

Product Documents for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...