SerpinB9 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33924PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-33924PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all SerpinB9 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERPINB9.

Source: E. coli

Amino Acid Sequence: YFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33924.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33924PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SerpinB9

SerpinB9 is a serine proteinase inhibitor of the ovalbumin like B clade of serpins. The mouse orthologue to PI9 is SPI-6. SerpinB9 was first discovered in human bone marrow in a search for serpins similar to SerpinB6. SerpinB9 was identified in lymphocytes, especially natural killer cells and cytotoxic T lymphocytes, cells which also produce and store the apoptosis-inducing enzyme Granzyme B. PI9 was shown to be a potent inhibitor of Granzyme B, working at picamolar efficiencies. PI9 was also shown to inhibit caspase 1, the interleukin 1 converting enzyme, thus blocking IL1 223; production, and decreasing inflammatory processes. Most leukemia cells and many tumor cells produce PI9, leading to speculation that PI9 may help protect tumor cells from destruction by NK and CTL cells. PI9 is also found in placenta, lung, kidney, mast cells, and many tissues and cell lines. In kidney transplant, PI9 is sharply elevated, and in the liver PI9 has been shown to be upregulated by a downstream estrogen promoter. SerpinB9 inhibits Granzyme B, and is cleaved by Granzyme M, as a down regulatory step. SerpinB9 also inhibits the bacterial proteinase subtilisin A, and this may be a protective agent against infections. Neutrophil elastase is also a target of SerpinB9. Like SerpinB6 and SerpinB8, SerpinB9 lacks a signal sequence, and is found mainly in the cytoplasm and nucleus, although it can be detected outside of cells and in serum. The original SerpinB9 sequence described was 379 amino acids in length, with predicted mass of 42.4 kDa and pI of 5.51.

Alternate Names

CAP-3, CAP3PI-9, Cytoplasmic antiproteinase 3, Peptidase inhibitor 9, PI9protease inhibitor 9 (ovalbumin type), serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9, serpin B9, serpin peptidase inhibitor, clade B (ovalbumin), member 9, serpin peptidase inhibitor, clade B, member 9

Gene Symbol

SERPINB9

Additional SerpinB9 Products

Product Documents for SerpinB9 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SerpinB9 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.